.
Are humans related to apes?
Geneticists (people who study such things) tell us that H. sapiens have great genetic similarity to members of the taxonomic group Family: Hominidae (great apes).
This seems to offend some people or to contradict their religious beliefs.
On what basis can argument be made that the classification is in error?
Are humans related to apes?
Moderator: Moderators
-
Zzyzx
- Site Supporter
- Posts: 25140
- Joined: Sat Mar 10, 2007 10:38 pm
- Location: Bible Belt USA
- Has thanked: 54 times
- Been thanked: 93 times
Are humans related to apes?
Post #1.
Non-Theist
ANY of the thousands of "gods" proposed, imagined, worshiped, loved, feared, and/or fought over by humans MAY exist -- awaiting verifiable evidence
Non-Theist
ANY of the thousands of "gods" proposed, imagined, worshiped, loved, feared, and/or fought over by humans MAY exist -- awaiting verifiable evidence
- EarthScienceguy
- Guru
- Posts: 2324
- Joined: Thu Aug 16, 2018 2:53 pm
- Has thanked: 35 times
- Been thanked: 46 times
- Contact:
Post #51
[Replying to post 42 by Zzyzx]
Unconformities (or 'non conformities') are well known to geologists and are widespread. They are NOT a 'problem' (except perhaps in the minds of some attempting to dispute scientific findings with pseudo-science in favor of theological dogma).
Quote:
An unconformity is a surface which at one time was subjected to erosion, either subaerial or submarine, that removed some of the section. An unconformity is characterized by a hiatus, a period of time for which no sediments are present. In stratigraphic interpretation, periods during which sediments were not being deposited are often lumped with erosonal unconformities, because the reason for the missing section may not be evident.
That would mean that 1.2 billion years of rock formation and deposition is missing and this layer is missing across most of the world. So where is 1.2 billion years of rock erosion and deposition hiding? This 1.2 billion years of missing rock is across the entire Earth. Can you say A LOT of missing rock?
https://news.wisc.edu/evidence-for-a-ge ... explosion/
All that needs to be done is to find this eroded rock and the mystery of the cambrian explosion would be solved. 200 years of looking and we still do not have any idea of where that eroded rock could be deposited. Keep looking I am just sure you will find it.
Was it subducted? If so why would older rock still be on the surface of the Earth without any evidence of 1.2 billion years of rock.
I do not know of a case of proven conformity between Cambrian and pre-Cambrian Algonkian rocks on the North American continent. In all localities where the contact is sufficiently extensive, or where fossils have been found in the basal Cambrian beds or above the basal conglomerate and coarser sandstones, an unconformity has been found to exist. Stated in another way, the pre-Cambrian land surface was formed of sedimentary, eruptive, and crystalline rocks that did not in any known instance immediately precede in deposition or origin the Cambrian sediments. Everywhere there is a stratigraphic and time break between the known pre-Cambrian rocks and Cambrian sediments of the North American continent.
"Charles D Walcott, "Abrupt Appearance of the Cambrian Fauna on the North American Continent", Cambrian Geology and Paleontology (1910)
https://en.wikipedia.org/wiki/Great_Unconformity
So what you have in the supposed rock record is are layers rock and then eons of missing rock layers before another rock layer with no evidence of where the deposition of the supposed eroded rock.
Unconformities (or 'non conformities') are well known to geologists and are widespread. They are NOT a 'problem' (except perhaps in the minds of some attempting to dispute scientific findings with pseudo-science in favor of theological dogma).
Quote:
An unconformity is a surface which at one time was subjected to erosion, either subaerial or submarine, that removed some of the section. An unconformity is characterized by a hiatus, a period of time for which no sediments are present. In stratigraphic interpretation, periods during which sediments were not being deposited are often lumped with erosonal unconformities, because the reason for the missing section may not be evident.
So, I can assume that you are of the belief that in the Great Nonconformity, "1.7 billion" year old rock that is directly underneath "500 million" year old Cambrian rock.There is a reasonable probability that depositional conditions changed during a hiatus and hence the sections above and below an unconformity are apt to be different. Hence, an unconformity is often marked by a fairly strong reflection, and unconformities often provide the dominant reflections. The reflection patterns above and below an unconformity are often different, and, thus, the dip is apt to be different, especially if the area was tilted during the hiatus. An unconformity is thus often marked by angularities with the unconformity reflection, both below and above the unconformity over at least some portions. Differences between the rocks below and above an unconformity at different locations cause the unconformity reflection to change character and sometimes even polarity. Unconformities may be difficult to recognize if they do not involve a change in dip.
https://wiki.seg.org/wiki/Unconformities
This is Earth science 101 (or Geology 101) material
That would mean that 1.2 billion years of rock formation and deposition is missing and this layer is missing across most of the world. So where is 1.2 billion years of rock erosion and deposition hiding? This 1.2 billion years of missing rock is across the entire Earth. Can you say A LOT of missing rock?
https://news.wisc.edu/evidence-for-a-ge ... explosion/
All that needs to be done is to find this eroded rock and the mystery of the cambrian explosion would be solved. 200 years of looking and we still do not have any idea of where that eroded rock could be deposited. Keep looking I am just sure you will find it.
Was it subducted? If so why would older rock still be on the surface of the Earth without any evidence of 1.2 billion years of rock.
I do not know of a case of proven conformity between Cambrian and pre-Cambrian Algonkian rocks on the North American continent. In all localities where the contact is sufficiently extensive, or where fossils have been found in the basal Cambrian beds or above the basal conglomerate and coarser sandstones, an unconformity has been found to exist. Stated in another way, the pre-Cambrian land surface was formed of sedimentary, eruptive, and crystalline rocks that did not in any known instance immediately precede in deposition or origin the Cambrian sediments. Everywhere there is a stratigraphic and time break between the known pre-Cambrian rocks and Cambrian sediments of the North American continent.
"Charles D Walcott, "Abrupt Appearance of the Cambrian Fauna on the North American Continent", Cambrian Geology and Paleontology (1910)
https://en.wikipedia.org/wiki/Great_Unconformity
So what you have in the supposed rock record is are layers rock and then eons of missing rock layers before another rock layer with no evidence of where the deposition of the supposed eroded rock.
- EarthScienceguy
- Guru
- Posts: 2324
- Joined: Thu Aug 16, 2018 2:53 pm
- Has thanked: 35 times
- Been thanked: 46 times
- Contact:
Post #52
[Replying to post 43 by DrNoGods]
That would be what is called field observations that cannot be explained by current geologic theory.
Well, maybe you can tell me where 1.2 billion years of eroded rock is deposited. Or maybe the 150 millions years of eroded rock is deposited between the Mauv layer and the layer right above it.Are you now polluting the Christianity and Agologetics section with this AIG nonsense? What you are referring to as "FACTS" are their cherry-picked attempts to pluck a few anomalies or open science issues on a subject, and claim that these invalidate decades and even centuries of actual science to instead favor biblical creationism.
That would be what is called field observations that cannot be explained by current geologic theory.
- EarthScienceguy
- Guru
- Posts: 2324
- Joined: Thu Aug 16, 2018 2:53 pm
- Has thanked: 35 times
- Been thanked: 46 times
- Contact:
Post #53
[Replying to post 45 by Danmark]
There was a time when scientist thought vestigial organs had not use in the Bible and creationist said just wait, you will find that they do have a use. Who was correct in that situation?
There was a time when it was thought that fossilization took millions of years and creationist said just wait there will be discovered a way that fossils can be formed in hundreds of years or less. Who was correct in that situation?
So just because we may not have all the answers at this present time just wait and you will see that the Bible will be proven correct. But now onto your comments.
It was once thought that inflation was the answer to this problem but observations in the last decade has not supported the theory of inflation. So current cosmology has a problem how does light travel over 27 billion years in only 13.7 billion years. along with the problem of such a consistent temperature.
It would make much more sense for the CBR to becaused by constant acceleration which would cause a constant temperature much better than inflation would.
This is one of the current theories in creation science.
Job 26:7 "He stretches out the north over the void and hangs the earth on nothing."
Isaiah 40:22
It is he who sits above the circle of the earth,
and its inhabitants are like grasshoppers;
who stretches out the heavens like a curtain,
and spreads them like a tent to dwell in;
There was a time when scientist told creationist that Junk dna was of no use and creationist said just wait you will find that it does have a use. Who was correct in that situation?What "FACTS" indicate the Bible has it right?
There was a time when scientist thought vestigial organs had not use in the Bible and creationist said just wait, you will find that they do have a use. Who was correct in that situation?
There was a time when it was thought that fossilization took millions of years and creationist said just wait there will be discovered a way that fossils can be formed in hundreds of years or less. Who was correct in that situation?
So just because we may not have all the answers at this present time just wait and you will see that the Bible will be proven correct. But now onto your comments.
Current cosmology states that the universe is 13.7 billion years old and yet the temperature across the cosmos is incredibly consistent. A cup of water on setting on a desk has more temperature deviation than the CBR.The Bible "FACTS" indicate the Earth is 6000 years old. Do you believe that?
It was once thought that inflation was the answer to this problem but observations in the last decade has not supported the theory of inflation. So current cosmology has a problem how does light travel over 27 billion years in only 13.7 billion years. along with the problem of such a consistent temperature.
It would make much more sense for the CBR to becaused by constant acceleration which would cause a constant temperature much better than inflation would.
This is one of the current theories in creation science.
What verse tells you that the Earth is flat?The Bible "FACTS" indicate the earth is flat and is the center of the solar system. Do you believe that?
Job 26:7 "He stretches out the north over the void and hangs the earth on nothing."
Isaiah 40:22
It is he who sits above the circle of the earth,
and its inhabitants are like grasshoppers;
who stretches out the heavens like a curtain,
and spreads them like a tent to dwell in;
It would actually be the Earth that would stop moving but from the point of view of a person on the Earth it would appear that the sun would have stopped.The Bible claims the Sun could stop moving. Do you believe that?
What problem would God have in doing any of these things? You are free not to believe in miracles. But the Bible has always been proven correct over time.The Bible claims an ass talked, a snake talked, fiery chariots flew and disappeared into the sky and that Jacob wrestled with God for hours and no one prevailed?*
-
Zzyzx
- Site Supporter
- Posts: 25140
- Joined: Sat Mar 10, 2007 10:38 pm
- Location: Bible Belt USA
- Has thanked: 54 times
- Been thanked: 93 times
Post #54
.
Those who study geology and hydrology understand that erosion is predominantly fluvial (conducted by running water) and that the end destination of running water on continents is ocean basins. Thus, sediments carried by running water eventually are deposited in oceans " that constitute 71% of the Earth surface (a LOT of space for deposits).
This is a response characteristic of pseudo-science.EarthScienceguy wrote: So where is 1.2 billion years of rock erosion and deposition hiding?
Those who study geology and hydrology understand that erosion is predominantly fluvial (conducted by running water) and that the end destination of running water on continents is ocean basins. Thus, sediments carried by running water eventually are deposited in oceans " that constitute 71% of the Earth surface (a LOT of space for deposits).
.
Non-Theist
ANY of the thousands of "gods" proposed, imagined, worshiped, loved, feared, and/or fought over by humans MAY exist -- awaiting verifiable evidence
Non-Theist
ANY of the thousands of "gods" proposed, imagined, worshiped, loved, feared, and/or fought over by humans MAY exist -- awaiting verifiable evidence
Post #55
EarthScienceguy wrote: [Replying to post 43 by DrNoGods]
Well, maybe you can tell me where 1.2 billion years of eroded rock is deposited. Or maybe the 150 millions years of eroded rock is deposited between the Mauv layer and the layer right above it.Are you now polluting the Christianity and Agologetics section with this AIG nonsense? What you are referring to as "FACTS" are their cherry-picked attempts to pluck a few anomalies or open science issues on a subject, and claim that these invalidate decades and even centuries of actual science to instead favor biblical creationism.
That would be what is called field observations that cannot be explained by current geologic theory.
In my experience, Christians almost NEVER discuss the details of biblical "Creation".
But they will discuss scientific evidence and theory at great length.
Would you care to give us the details behind the mud-man and his rib-woman good helper
With the same level of demand for evidence ?

"God" … just whatever humans imagine it to be.
"Scripture" … just whatever humans write it to be.
"Scripture" … just whatever humans write it to be.
-
Zzyzx
- Site Supporter
- Posts: 25140
- Joined: Sat Mar 10, 2007 10:38 pm
- Location: Bible Belt USA
- Has thanked: 54 times
- Been thanked: 93 times
Post #56
.
Okay, let's be biblical and stop Earth rotation -- and consider the results.EarthScienceguy wrote:It would actually be the Earth that would stop moving but from the point of view of a person on the Earth it would appear that the sun would have stopped.The Bible claims the Sun could stop moving. Do you believe that?
Ancient storytellers were not likely aware of these effects, so their stories could tell of the Earth stopping rotation so favored armies could win a battle. Modern people have access to more accurate information (though many may prefer to remain unaware).If Earth Suddenly Stopped Spinning
Our atmosphere is rotating at the same rate Earth is spinning: approximately 1050 miles per hour at the equator, with the speed decreasing the further north or south you go from the equator.
If the Earth suddenly stopped rotating, the atmosphere would still continue moving at 1050 miles per hour, and anything not attached to bedrock would be ripped off the surface of the planet. This includes rocks, trees, buildings, people " all thrown sideways at a speed of 1050 mph (at the equator). Could you imagine the oceans being pushed inland with that speed? Oceans would travel approximately 17 miles (28 kilometers) inland in just 60 seconds.
http://thescienceexplorer.com/universe/ ... d-spinning
.
Non-Theist
ANY of the thousands of "gods" proposed, imagined, worshiped, loved, feared, and/or fought over by humans MAY exist -- awaiting verifiable evidence
Non-Theist
ANY of the thousands of "gods" proposed, imagined, worshiped, loved, feared, and/or fought over by humans MAY exist -- awaiting verifiable evidence
-
Bust Nak
- Savant
- Posts: 9874
- Joined: Mon Feb 27, 2012 6:03 am
- Location: Planet Earth
- Has thanked: 189 times
- Been thanked: 267 times
Post #57
Scientists. Creationists are getting non-coding DNA mixed up Junk DNA.EarthScienceguy wrote: There was a time when scientist told creationist that Junk dna was of no use and creationist said just wait you will find that it does have a use. Who was correct in that situation?
Scientists. Creationists are confused about vestigial organs that have been repurposed and does not function as they did in their ancestors.There was a time when scientist thought vestigial organs had not use in the Bible and creationist said just wait, you will find that they do have a use. Who was correct in that situation?
Scientists. Creationists are getting fossilization and mineralization mixed up.There was a time when it was thought that fossilization took millions of years and creationist said just wait there will be discovered a way that fossils can be formed in hundreds of years or less. Who was correct in that situation?
- Difflugia
- Prodigy
- Posts: 4127
- Joined: Wed Jun 12, 2019 10:25 am
- Location: Michigan
- Has thanked: 4446 times
- Been thanked: 2642 times
Post #58
Oh, good. Someone I can talk genes to.
Before the 1990s, creationists claimed that non-coding DNA simply shouldn't exist unless God did it because evolution should simply remove it. Scientists saw the same thing, but instead of throwing up their hands and saying "God," they started looking for patterns.
Around 1993 or 1994 or so, someone discovered Alu elements (check pubmed or Google scholar). They didn't know why they were there at first, but they knew they were conserved far more than genuine "junk" (pseudogenes and the like). Since then, various regulatory functions have been described. During the intervening twenty-five years, creationists blathered on as though this somehow helps their case, but it doesn't. When it comes right down to it, these elements are inherited in exactly the same way as protein-coding DNA and subject to the same selection pressures. Segments of conserved, non-coding DNA show the same patterns as the mitochondrial genes I talked about in a previous post, which show the same patterns as somatic genes. The only thing creationists can do is shout that there was something that the scientists hadn't known earlier. Not that the creationists knew anything, but apparently the thinking goes that if scientists didn't know everything all at once, then maybe the creationists could be right about something.
SPOILER: They're not. Ever.
No, that's not what happened. I've been reading creationist apologetics for getting on thirty years now. What creationists "have been saying for a long time" is that evolution can't explain "junk" DNA. Their excuses have changed through the years, but that's their entire refrain about everything: "science can't explain x."EarthScienceguy wrote:There was a time when scientist told creationist that Junk dna was of no use and creationist said just wait you will find that it does have a use. Who was correct in that situation?
Before the 1990s, creationists claimed that non-coding DNA simply shouldn't exist unless God did it because evolution should simply remove it. Scientists saw the same thing, but instead of throwing up their hands and saying "God," they started looking for patterns.
Around 1993 or 1994 or so, someone discovered Alu elements (check pubmed or Google scholar). They didn't know why they were there at first, but they knew they were conserved far more than genuine "junk" (pseudogenes and the like). Since then, various regulatory functions have been described. During the intervening twenty-five years, creationists blathered on as though this somehow helps their case, but it doesn't. When it comes right down to it, these elements are inherited in exactly the same way as protein-coding DNA and subject to the same selection pressures. Segments of conserved, non-coding DNA show the same patterns as the mitochondrial genes I talked about in a previous post, which show the same patterns as somatic genes. The only thing creationists can do is shout that there was something that the scientists hadn't known earlier. Not that the creationists knew anything, but apparently the thinking goes that if scientists didn't know everything all at once, then maybe the creationists could be right about something.
SPOILER: They're not. Ever.
Post #59
This entire debate is founded on are we holy or are we nothing more then animals, beasts in the field... Surely the flesh is nothing more then a beast, but the spirit is of God! The battle between the flesh and the spirit is real... or is it? Maybe let them be separate... Jesus said the flesh counts for nothing but the spirit gives life... have faith! Be holy! The dang flesh! Call me a sinner and convict me for my crime. Im sorry, it was in my face, I question if I have choice, but give me the strength and lead us not in temptation but deliver us
- Goose
- Guru
- Posts: 1739
- Joined: Wed Oct 02, 2013 6:49 pm
- Location: The Great White North
- Has thanked: 85 times
- Been thanked: 76 times
Post #60
I took the data you provided and collected similar COX2 data for some other organisms chosen at random (some primates, some not). I then used the alignment tool at UniProt to check for similarities in the sequences. The results were interesting to say the least.Difflugia wrote: In the dual interests of answering the OP and showing that everyone has research-grade tools and data available to them, I generated a phylogenetic tree of a smattering of primates. It shows humans right where they should be, clustered with the great apes. I annotated the image to show what the main branches correspond to.
[row][center]Name[/center][col][center]Order[/center][col]Similarity to human[col]Identical positions [row]Chimpanzee[col][center]Primate[/center][col][center]97.797%[/center][col][center]222[/center] [row]Gorilla[col][center]Primate[/center][col][center]96.467%[/center][col][center]219[/center] [row]Gibbon[col][center]Primate[/center][col][center]94.273% [/center][col][center]214[/center] [row]Orangutan[col][center]Primate[/center][col][center]94.174% [/center][col][center]215[/center] [row]Macaque[col][center]Primate[/center][col][center]89.427% [/center][col][center]203[/center] [row]Rhesus[col][center]Primate[/center][col][center]88.106% [/center][col][center]200[/center] [row]Langur[col][center]Primate[/center][col][center]88.106% [/center][col][center]200[/center] [row]Colobus[col][center]Primate[/center][col][center]88.106% [/center][col][center]200[/center] [row]Barbary ape[col][center]Primate[/center][col][center]88.106% [/center][col][center]200[/center] [row]Baboon[col][center]Primate[/center][col][center]87.665% [/center][col][center]199[/center] [row]Leaf monkey[col][center]Primate[/center][col][center]87.225% [/center][col][center]198[/center] [row][b][color=red]Seal[/color][/b][col][center][b][color=red]Carnivora[/color][/b][/center][col][center][b][color=red]74.123%[/color][/b][/center][col][center][b][color=red]169[/color][/b][/center] [row]Tarsier[col][center]Primate[/center][col][center]73.568% [/center][col][center]167[/center] [row][b][color=red]Gray whale[/color][/b][col][center][b][color=red]Artiodactyla[/color][/b][/center][col][center][b][color=red]73.128%[/color][/b][/center][col][center][b][color=red]166[/color][/b][/center] [row][b][color=red]Dog[/color][/b][col][center][b][color=red]Carnivora[/color][/b][/center][col][center][b][color=red]73.128%[/color][/b] [/center][col][center][b][color=red]166[/color][/b][/center] [row][b][color=red]Horse[/color][/b][col][center][b][color=red]Perissodactyla[/color][/b][/center][col][center][b][color=red]73.128%[/color][/b][/center][col][center][b][color=red]166[/color][/b][/center] [row]Galago[col][center]Primate[/center][col][center]72.687% [/center][col][center]165[/center] [row][b][color=red]Rabbit[/color][/b][col][center][b][color=red]Lagomorpha[/color][/b][/center][col][center][b][color=red]72.247%[/color][/b][/center][col][center][b][color=red]164[/color][/b][/center] [row]Slender Loris[col][center]Primate[/center][col][center]72.247%[/center][col][center]164[/center] [row]Giant Mouse Lemur[col][center]Primate[/center][col][center]71.366%[/center][col][center]162[/center] [row]Sifaka[col][center]Primate[/center][col][center]71.366% [/center][col][center]162[/center] [row]Dwarf lemur[col][center]Primate[/center][col][center]71.366%[/center][col][center]162[/center] [row]Ring tailed[col][center]Primate[/center][col][center]71.366%[/center][col][center]162[/center] [row]Sportive lemur[col][center]Primate[/center][col][center]70.485%[/center][col][center]160[/center] [row]Azaras night monkey[col][center]Primate[/center][col][center]69.869%[/center][col][center]160[/center] [row]Squirrel monkey[col][center]Primate[/center][col][center]69.163% [/center][col][center]157[/center] [row]Black titi[col][center]Primate[/center][col][center]68.996% [/center][col][center]158[/center] [row][b][color=red]Iguana[/color][/b][col][center][b][color=red]Squamata[/color][/b][/center][col][center][b][color=red]68.559%[/color][/b][/center][col][center][b][color=red]157[/color][/b][/center] [row]wieds marmoset[col][center]Primate[/center][col][center]68.559%[/center][col][center]157[/center] [row][b][color=red]Frog[/color][/b][col][center][b][color=red]Anura[/color][/b][/center][col][center][b][color=red]68.122%[/color][/b][/center][col][center][b][color=red]156[/color][/b][/center] [row]Tufted capuchin[col][center]Primate[/center][col][center]67.686% [/center][col][center]155[/center] [row]Bearded saki [col][center]Primate[/center][col][center]67.249% [/center][col][center]154[/center] [row][b][color=red]Shark[/color][/b][col][center][b][color=red]Carcharhiniformes[/color][/b][/center][col][center][b][color=red]65.217%[/color][/b][/center][col][center][b][color=red]150[/color][/b][/center]
Code: Select all
>dog
MAYPFQLGLQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETVWTILPA
IILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLNFDSYMIPTQELKPGELRLLEVDN
RVVLPMEMTIRMLISSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMAMRPGLYYGQCSEICGSNHSFMPIV
LEMVPLSYFETWSALMV
>human
MAHAAQVGLQDATSPIMEELITFHDHALMIIFLICFLVLYALFLTLTTKLTNTNISDAQEMETVWTILPA
IILVLIALPSLRILYMTDEVNDPSLTIKSIGHQWYWTYEYTDYGGLIFNSYMLPPLFLEPGDLRLLDVDN
RVVLPIEAPIRMMITSQDVLHSWAVPTLGLKTDAIPGRLNQTTFTATRPGVYYGQCSEICGANHSFMPIV
LELIPLKIFEMGPVFTL
>gorilla
MAHAAQVGLQDATSPIMEELIIFHDHALMIIFLICFLVLYALFLTLTTKLTNNNISDAQEMETIWTILPA
IILVLIALPSLRILYMTDEINDPSFTIKSIGHQWYWTYEYTDYGGLIFNSYMLPPLFLEPGDLRLLDVDN
RVVLPVEAPVRMMITSQDVLHSWAVPTLGLKTDAIPGRLNQTTFTATRPGVYYGQCSEICGANHSFMPIV
LELIPLKIFEMGPVFAL
>rhesus
MAHPVQLSLQDATSPVMEELITFHDHAFMAMSLISFLVLYALLSTLTTKLTNTSITDAQEMETIWTILPA
IILILIALPSLRILYLTDEVNDPSFTIKSIGHQWYWTYEYTDYGSLIFNSYMLPPLFLNPGDLRLLEVDN
RVVLPIEAPVRMMITSQDVLHSWTIPTLGLKTDAVPGRLNQTVFTATRPGVYYGQCSEICGANHSFMPIV
AELIPLKIFEMGPVFTL
>bonobo
MAHAAQVGLQDATSPIMEELIIFHDHALMIIFLICFLVLYALFLTLTTKLTNTSISDAQEMETVWTILPA
IILVLIALPSLRILYMTDEVNDPSFTIKSIGHQWYWTYEYTDYGGLIFNSYMLPPLFLEPGDLRLLDVDN
RVVLPVEAPVRMMITSQDVLHSWAVPTLGLKTDAIPGRLNQTTFTATRPGVYYGQCSEICGANHSFMPIV
LELIPLKIFEMGPVFAL
>chimpanzee
MAHAAQVGLQDATSPIMEELIIFHDHALMIIFLICFLVLYALFLTLTTKLTNTSISDAQEMETVWTILPA
IILVLIALPSLRILYMTDEVNDPSFTIKSIGHQWYWTYEYTDYGGLIFNSYMLPPLFLEPGDLRLLDVDN
RVVLPVEAPVRMMITSQDVLHSWAVPTLGLKTDAIPGRLNQTTFTATRPGVYYGQCSEICGANHSFMPIV
LELIPLKIFEMGPVFTL
>macaque
MAHPVQLSLQDATSPIMEELITFHDHAFMAMSLISFLVLYALLSTLTTKLTNTNITDAQEMETIWTILPA
IILILIALPSLRILYLTDEVNDPSFTIKSIGHQWYWTYEYTDYGGLIFNSYMLPPLFLNPGDLRLLEVDN
RVVLPIEAPVRMMITSQDVLHSWTIPTLGLKTDAVPGRLNQTVFTATRPGVYYGQCSEICGANHSFMPIV
AELIPLKIFEMGPVFTL
>sifaka
MAYPVQLGFQDAASPIMEELLYFHDHTLMIVFLISSLVLYIISLMLTTKLMHTSTMDAQEVETVWTILPA
IILILIALPSLRILYMMDEITTPSLTLKTMGHQWYWSYEYTDYEDLSFDSYMVPSSDLKPGELRLLEVDN
RVVLPTELSIRMLISSEDVLHSWAVPSLGVKTDAIPGRLNQATLMTSRPGIYYGQCSEICGANHSFMPIV
LELVPLKHFEEWLLSMF
>colobus
MAHPVQLGLQDATSPIMEELIAFHDHALMIVCLISFLVLYVLSSVLMTKLTNTNITDAQEMETIWTILPA
IILILIALPSLRILYLTDEINNPSFTIKSIGHQWYWTYEYTDYGGLIFNSYMLPPLFLNPGDLRLLEVDN
RVVLPIEAPVRMMITSQDVLHSWTIPTLGLKTDAVPGRLNQTTFTAMRPGVYYGQCSEICGANHSFMPIV
AELIPLKIFEMGPVFTL
>ring-tailed
MAYPVQLGFQDAASPIMEELLYFHDHTLMIMFLISSLVLYIISLMLTTELMHTNTMDAQEVETVWTILPA
AILILIALPSLRILYMMDEITTPSLTLKTMGHQWYWSYEYTDYEDLCFDSYMTPSSDLKPGELRLLEVDN
RVVLPTELAVRMLISSEDVLHSWTVPSLGVKTDAIPGRLNQATLMASRPGVYYGQCSEICGANHSFMPIV
LELVPLKHFEEWLLSML
>barbary_ape
MAHPVQLSLQDATSPVMEELITFHDHAFMAMSLISFLVLYALLSTLTTKLTNTNITNAQEMETIWTILPA
IILILIALPSLRILYLTDEINDPSFTIKSIGHQWYWTYEYTDYGGLIFNSYMLPPLFLNPGDLRLLEVDN
RVVLPIEASVRMMITSQDVLHSWAIPTLGLKTDAVPGRLNQTVFTATRPGVYYGQCSEICGANHSFMPIV
AELIPLKIFEMGPVFTL
>tarsier
MAHSFQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIITLMLTTKLTHTSTMDAQEVETVWTILPA
IILILIALPSLRILYLMDEINTPSLTVKTMGHQWYWSYEYTDYEDLNFDSYMIPTADLKPGELRLLEVDN
RVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLNQATLMSTRPGLYYGQCSEICGSNHSFMPIV
LELVPLKHFENWSTSMI
>orangutan
MAHAAQVGLQDATSPIMEELVIFHDHALMIIFLICFLVLYALFLTLTTKLTNTSISDAQEMETIWTILPA
IILILIALPSLRILYLTDEINDPSFTIKSIGHQWYWTYEYTDYGGLIFNSYMLPPLFLEPGDLRLLDVDN
RVVLPVEAPVRMMITSQDVLHSWTVPSLGLKTDAIPGRLNQTTFTATRPGVYYGQCSEICGANHSFMPIV
LELIPLKIFEMGPVFTL
>gibbon
MAHATQVGLQDATSPIMEELISFHDHALMIIFLISFLVLYALFLTLTTKLTNTNITDAQEMETVWTILPA
IILVLIALPSLRILYLTDEINDPSFTIKAIGHQWYWAYEYTDYGGLIFNSYMLPPLFLEPGDLRLLEVDN
RVVLPIEAPVRMMITSQDVLHSWTVPSLGLKTDAIPGRLNQTTFTATRPGVYYGQCSEICGANHSFMPIV
LELIPLKIFEMGPVFTL
>baboon
MAHPVQLGLQDATSPVMEELITFLDQALMAMFLISFLILYALSSTLTTKLTNTNITDAQEMETIWTILPA
VILILIALPSLRILYMTDEINNPSFTIKSIGHQWYWTYEYTDYGGLIFNSYMLPPLFLNPGDLRLLEVDF
RVVLPIEAPVRMMITSQDVLHSWTIPTLGLKTDAVPGRLNQTVFTATRPGVYYGQCSEICGANHSFMPIV
AELIPLKIFEMGPVFTL
>langur
MAHPVQLGLQDATSPIMEELIAFHDHAFMIVTLISFLVLYVLSSVLTTKLTNTNITDAQEMETIWTVLPA
VILVLIALPSLRILYLTDEINNPSFTIKSIGHQWYWTYEYTDYGGLIFNSYMLPPLFLNPGDLRLLEVDN
RVVLPIEAPVRMMITSQDVLHSWTIPTLGLKTDAIPGRLNQTTFTAMRPGVYYGQCSEICGANHSFMPIV
AELIPLKIFEMGPVFTL
>leaf_monkey
MAHPVQLGLQDATSPIMEELIAFHDHTFMIVSLISFLVLYVLSSVLTTKLISTNITDAQEMETIWTILPA
IILVLIALPSLRILYLTDEINNPSFTIKSIGHQWYWTYEYTDYGGLIFNSYMLPSLFLNPGDLRLLEVDN
RVVLPIEAPVRMMITSQDVLHSWTIPTLGLKTDAIPGRLNQTTFTAMRPGVYYGQCSEICGANHSFMPIV
AELIPLKIFEMGPVFTL
>black_titi
MAHPAQLGLQNAASPIMEELIAFHDHALMIIFLISSLVLYIISLMLTTKLTHTSTMNAQEIEMIWTILPA
IILIMIALPSLRILYMTDEFNKPYLTLKAIGHQWYWSYEYSDYEDLAFDSYIMPTYFLEPGEFRLLEVDN
RTTLPMEADIRMLISSQDVLHSWAVPSLGVKADAIPGRLNQAMVASMRPGLFYGQCSEICGSNHSFMPIV
LEFIYFQDFEVWASYLYIV
>bearded_saki
MATPAQLGLQNATSPIMEELIAFHDHTLMIIFLISSLVLYIISLMLTTKLTHTSTMNAQEIETIWTILPA
IILIMIALPSLRILYMTDEFNKPYLTLKAIGHQWYWSYEYSDYEDLFFDSYIMPTYYLQPGEFRLLEVDN
RTTLPMEADIRYLISSQDVLHSWTVPSLGVKADAIPGRLNQAMLASMRPGLFYGQCSEICGSNHSFMPIV
LEFIYFQDFEVWASYLYIV
>azaras_night_monkey
MATPAQLGLQNATSPIMEELIAFHDHALMIIFLISSLVLYIISLMLTTKLTHTSTMNAQEIEMIWTILPA
IILIMIALPSLRILYMTDEFNKPYLTLKAIGHQWYWSYEYSDYEDLAFDSYITPTYFLEPGEFRLLEVDN
RTTLPMEADIRMLITSQDVLHSWAVPSLGVKTDAIPGRLNQAMLASMRPGLFYGQCSEICGSNHSFMPIV
LEFIYFQDFEVWASYLYIV
>wieds_marmoset
MAAPAQLGLQNAASPIMEELIAFHDHALMIIFLISSLVLYIISLMLTTKLTHTSTMNAQEIEMIWTILPA
MILIMIALPSLRILYMTDEFNKPYLTLKAIGHQWYWSYEYSDYEDLAFDSYIMPTYFLEPGEFRLLEVDN
RTTLPMEADIRVLISSQDVLHSWAVPSLGVKTDAIPGRLNQAMVASMRPGLYYGQCSEICGSNHSFMPIV
LEFIYFQDFEVWASYLYIV
>tufted_capuchin
MATPAQLGLQNATSPIMEELIAFHDHTLMIIFLISSLVLYIISLMLTTKLTHTSTMNAQEIEMIWTILPA
IILIMIALPSLRILYMTDEFNKPYLTLKAIGHQWYWSYEYSDYEDLFFDSYIMPTYYLQPGEFRLLEVDN
RTTLPMEADIRMLISSQDVLHSWAVPSLGVKADAIPGRLNQAMLASMRPGLFYGQCSEICGSNHSFMPIV
LEFIYFQDFEVWASYLYIV
>squirrel_monkey
MATPAQLGLQNATSPIMEELIAFHDHALMIIFLISSLVLYIMSLMLTTKLTHTSTMNAQEIEMIWTILPA
IILIMIALPSLRILYMTDEFIKPYLTLKAIGHQWYWSYEYSDYEDLAFDSYIMPTYFLEPGEFRLLEVDN
RTTLPMEADIRMLVSSHDVLHSWAVPSLGVKTDAIPGRLNQITLASMRPGLFYGQCSEICGSNHSFMPIV
LEFIYFQDFEVWAS
>sportive_lemur
MACPVQLGFQDAASPIMEELLYFHDHTLMIVFLISSLVLYIISLMLSTKLTHTSTVDAQEVETVWTILPA
VILILIALPSLRILYMMDEITTPSLTVKTMGHQWYWSYEYTDYENLCFDSYMIPLLDLKPGDLRLLEVDN
RVALPTEMSIRMLVSSEDVLHSWTVPSLGVKTDAIPGRLNQVTLMTSRPGIYYGQCSEICGANHSFMPIV
LELVSLKHFEEWLLTLL
>giant_mouse_lemur
MAYPAQFGLQDAASPIMEELAYFHDHTLMIVFLISSMVLYMISLMLTTELTHTSTMDAQEVETVWTILPA
VILIFIALPSLRILYMMDEITTPSLTLKTMGHQWYWSYEYTDYESLCFDSYMTPPLELDPGELRLLEVDN
RVVLPTEMSIRMLVSSEDVLHSWTVPALGVKTDAIPGRLNQATLMTSRPGIYYGQCSEICGANHSFMPIV
LELVPLKHFEEWLLSML
>dwarf_lemur
MACPVQLGFQDAASPIMEELMYFHDHTLMIVFLISSLVLYIISLMLTTELTHTSTMDAQEVETVWTILPA
VILILIALPSLRILYMMDEITTPSLTLKTMGHQWYWSYEYTDYENLCFDSYMTPSSDLKPGELRLLEVDN
RVVLPTEMSIRMLISSEDVLHSWTVPSLGVKTDAIPGRLNQTTLMTSRPGIYYGQCSEICGANHSFMPIV
LELVPLKHFEEWLLAML
>Seal
MAYPFQMGLQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTNTMDAQEVETVWTILPA
IILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLNFDSYMIPTQDLKPGELRLLEVDN
RVVLPMEMTIRMLISSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSTRPGLYYGQCSEICGSNHSFMPIV
LELVPLSHFEKWSTSMLQ
>Gray whale
MAYPFQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIITLMLTTKLTHTSTMDAQEVETIWTILPA
IILILIALPSLRILYMMDEVNNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSDLKPGELRLLEVDN
RVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSTRPGLFYGQCSEICGSNHSFMPIV
LELVPLEIFEKWSASML
>Horse
MAYPFQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISSMLTTKLTHTSTMDAQEVETIWTILPA
IILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLTFDSYMIPTSDLKPGELRLLEVDN
RVVLPMEMTIRMLISSEDVLHSWAVPSLGLKTDAIPGRLNQTTLVASRPGLYYGQCSEICGSNHSFMPIV
LELVPLKHFEEWSASML
>Galago
MAHAVQFGFQDAASPIMEELLYFHDHTLMIVFTISSLVLYIISLMLSTELTHTNTMDAQEVETVWTILPA
VILILIALPSLRILYMMDEINTPSLTLKTMGHQWYWSYEYTDYDNLCFDSYMTPTPDLEPGDLRLLEVDN
RVVLPTEMSIRMLISSEDVLHSWTVPALGIKTDAIPGRLNQATLMTSRVGIYYGQCSEICGANHSFMPIV
LELVPLKYFEEWLLKTL
>Rabbit
MAYPFQLGFQDASSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPA
IILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLNFDSYMIPTSDLNPGDLRLLEVDN
RVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLNQATLISTRPGLFYGQCSEICGSNHSFMPIV
LEMVPLKHFENWSLSMI
>Slender Loris
MAHPVQFGFQDAASPIMEELLYFHDHTLMIVFMISSLVLYIISLMLSTELTHTSTMDAQEVETVWTILPA
VILILIALPSLRILYMMDEINTPSLTLKTMGHQWYWSYEYTDYDKLCFDSYMVPTPDLEPGDLRLLEVDN
RVVLPTEMSIRMLISSEDVLHSWTVPALGIKTDAIPGRLNQATIMTSRPGIYYGQCSEICGANHSFMPIV
LELVPLKYFEEWLLKTL
>Iguana
MAHPSQLGFQDAASPIMEELLHFHDHALMIVFLISALVLYTITLMITTTLTHTNTMDAQEVEMIWTILPA
IILILIALPSLRILYLMDEINNPHLTIKTLGHQWYWSYEYTDYEDLTFDSYMTPTQDLTPGSFRLLEVDN
RMVVPMESPIRMLISAEDVLHSWAVPTLGIKTDAIPGRLNQTTFITSHPGLFYGQCSEICGSNHSFMPIV
VEAVPLQHFESWSTTLLSS
>Frog
MAHPSQLGFQDAASPIMEELLHFHDHTLMAVFLISTLVLYIITIMMTTKLTNTNLMDAQEIEMVWTIMPA
ISLIMIALPSLRILYLMDEVNDPHLTIKAIGHQWYWSYEYTNYEDLSFDSYMIPTNDLTPGQFRLLEVDN
RMVVPMESPTRLLVTAEDVLHSWAVPSLGVKTDAIPGRLHQTSFIATRPGVFYGQCSEICGANHSFMPIV
VEAVPLTDFENWSSSMLEA
>Shark
MAHPSQLGFQDAASPVMEELIHFHDHTLMIVFLISTLVLYIITAMVTTKLTNKYILDSQEIEIVWTILPA
IILVMIALPSLRILYLMDEINDPHLTIKAMGHQWYWSYEYTDYEDLGFDSYMIQTQDLTPGQFRLLETDH
RMVVPMESPIRVLVSAEDVLHSWTVPALGVKMDAVPGRLNQTAFIVSRPGIYYGQCSEICGANHSFMPIV
VEAVPLEHFEAWSSSMLEEA
Iguana
African clawed frog (Xenopus laevis)
Seal (Mirounga angustirostris)
Gray whale(Eschrichtius robustus)
Rabbit (Oryctolagus cuniculus)
Horse (Equus caballus)
Galago (Otolemur crassicaudatus)
Slender loris (Loris lydekkerianus)
Shark (Glyphis glyphis)
Wouldnt we expect from evolution that all the primates are more similar to humans than non-primates? If common descent were true then we would expect all the primates to show a closer similarity to humans than the other non-primates. Certainly, if the theory were true, then we would expect the Wieds marmoset, the Tufted capuchin, and the Bearded saki to show a markedly closer similarity to humans than the Iguana. On a purely logical basis, this is tantamount to falsification via modus tollens.Those relationships are either from evolution or God put them there to look exactly like we would expect from evolution.
If this data holds, you are more closely related to a seal, whale, dog, horse, and rabbit than you are to numerous other primates. If the data holds you are even more closely related to an Iguana than you are to a Wied's marmoset, Tufted capuchin, and Bearded saki.
It takes ad hoc explanations such as Horizontal Gene Transfer to explain away the contradictions in the data. When the evidence supports the theory, the evidence is good. When the evidence contradicts the theory, the evidence is bad and must have an explanation because the theory is true.
Things atheists say:
"Is it the case [that torturing and killing babies for fun is immoral]? Prove it." - Bust Nak
"For the record...I think the Gospels are intentional fiction and Jesus wasn't a real guy." – Difflugia
"Julius Caesar and Jesus both didn't exist." - brunumb
"...most atheists have no arguments or evidence to disprove God." – unknown soldier (a.k.a. the banned member Jagella)
"Is it the case [that torturing and killing babies for fun is immoral]? Prove it." - Bust Nak
"For the record...I think the Gospels are intentional fiction and Jesus wasn't a real guy." – Difflugia
"Julius Caesar and Jesus both didn't exist." - brunumb
"...most atheists have no arguments or evidence to disprove God." – unknown soldier (a.k.a. the banned member Jagella)


